Sr. Software Engineer - (ISO 20022, SWIFT, CHIPS, and Fedwire payment ecosystems)

U.S. Bank

Charlotte (NC)

Hybrid

USD 112,000 - 131,000

Full time

2 days ago
Be an early applicant
Application generator

Turn this role into an interview — a resume and cover letter built around what this employer wants.

Get past ATS filters

Benefits offered by this job

Healthcare benefits (medical, dental,
Life insurance
Disability coverage
Parental leave
401(k) and retirement plan
Paid vacation
Paid holidays
Adoption assistance
Sick leave

Job summary

U.S. Bank is seeking an experienced Payments Engineer with deep expertise in global payments, wire transfer processing, and modern payment messaging standards.

The role focuses on designing, developing, and modernizing mission-critical payment platforms for domestic and international transfers. You will lead implementation across SWIFT, CHIPS, Fedwire, and ISO 20022 ecosystems, architect scalable cloud-native solutions, and collaborate across business, operations, and technology teams to ensure

Qualifications

  • Bachelor's degree or equivalent work experience.
  • Five to six years of relevant experience.
  • Deep knowledge of Global Payments, Wire Transfers, and Financial Services technology.

Responsibilities

  • Design, develop, and enhance enterprise-scale payment processing platforms supporting domestic and international wire transfers.
  • Lead implementation and integration of payments solutions across SWIFT, CHIPS, Fedwire, and ISO 20022 messaging ecosystems.
  • Architect and modernize payments systems utilizing cloud-native technologies, distributed architectures, and API-driven services.
  • Collaborate with business, operations, and technology teams to deliver resilient, secure, and scalable payment capabilities.
  • Drive payment transformation initiatives including legacy platform modernization and migration to next-generation architectures.
  • Ensure payment applications meet regulatory, compliance, risk, and operational requirements across networks.
  • Lead technical design reviews, establish engineering standards, and provide mentorship to development teams.
  • Troubleshoot complex payment processing issues and optimize system performance.

Skills

Global payments
Wire transfers
Payment processing
ISO 20022
SWIFT
Cloud platforms
Java & Spring Boot
Microservices
REST APIs
Kafka / JMS

Education

Bachelor's degree or equivalent

Tools

Kafka
IBM MQ
JMS
Event-Driven Architecture

Job description

At U.S. Bank, we're on a journey to do our best. Helping the customers and businesses we serve to make better and smarter financial decisions and enabling the communities we support to grow and succeed. We believe it takes all of us to bring our shared ambition to life, and each person is unique in their potential. A career with U.S. Bank gives you a wide, ever-growing range of opportunities to discover what makes you thrive at every stage of your career. Try new things, learn new skills and discover what you excel at-all from Day One.

Job Description

U.S Bank is seeking an experienced Payments Engineer with deep expertise in global payments, wire transfer processing, and modern payment messaging standards. The ideal candidate will possess strong domain knowledge across payment networks and a proven technology background leading the design, development, and modernization of mission-critical payment platforms.

Essential Responsibilities
  • Design,develop,andenhanceenterprise-scalepaymentprocessingplatformssupportingdomesticandinternationalwiretransfers.
  • Leadtheimplementationandintegrationofpaymentsolutionsacross SWIFT, CHIPS, Fedwire, and ISO 20022 messagingecosystems.
  • Architectandmodernizepaymentsystemsutilizingcloud-nativetechnologies,distributedarchitectures,andAPI-drivenservices.
  • Collaboratewithbusiness,operations,andtechnologyteamstodeliverresilient,secure,andscalablepaymentcapabilities.
  • Drivepaymenttransformationinitiatives,includinglegacyplatformmodernizationandmigrationtonext-generationpaymentarchitectures.
  • Ensurepaymentapplicationsmeetregulatory,compliance,risk,andoperationalrequirementsacrossmultiplepaymentnetworks.
  • Leadtechnicaldesignreviews,establishengineeringstandards,andprovidementorshiptodevelopmentteams.
  • Troubleshootcomplexpaymentprocessingissues,optimizesystemperformance,andimprovepaymentlifecycleefficiencyfrominitiationthroughsettlement.
Basic Qualifications
  • Bachelor's degree, or equivalent work experience
  • Five to six years of relevant experience
Preferred Skills/Experience
  • Deep expertise in Global Payments, Wire Transfers, Payment Processing Platforms, and Financial Services Technology.
  • Advanced knowledge of ISO 20022, SWIFT, CHIPS, Fedwire, Payment Messaging Standards, and Cross-Border Payments.
  • Strongunderstandingof Payment Operations, Clearing, Settlement, Liquidity Management, Cash Management, and Correspondent Banking.
  • Experience designing and implementing Large-Scale Payment Systems, Real-Time Payments, High-Volume Transaction Processing, and Enterprise Integrations.
  • Proficiency in Java, Spring Boot, Microservices Architecture, Distributed Systems, REST APIs, and Secure Application Development.
  • Hands-onexperiencewith Messaging Technologies including Kafka, IBM MQ, JMS, Event-Driven Architecture, and Enterprise Integration Patterns.
  • StrongknowledgeofCloudPlatforms(AWS,Azure,orGCP),Containerization,Kubernetes,OpenShift,CI/CDPipelines,andCloud-NativeEngineering.
  • ProvenleadershipinPaymentModernization,DigitalTransformation,PlatformMigration,SolutionArchitecture,TechnicalStrategy,andAgileDelivery.
Location expectations

This role requires working from a U.S. Bank location three (3) or more days per week.

If there's anything we can do to accommodate a disability during any portion of the application or hiring process, please refer to our disability accommodations for applicants https://careers.usbank.com/global/en/disability-accommodations-for-applicants

Benefits
  • Healthcare (medical, dental, vision)
  • Basic term and optional term life insurance
  • Short-term and long-term disability
  • Pregnancy disability and parental leave
  • 401(k) and employer-funded retirement plan
  • Paid vacation (from two to five weeks depending on salary grade and tenure)
  • Up to 11 paid holiday opportunities
  • Adoption assistance
  • Sick and Safe Leave accruals of one hour for every 30 worked, up to 80 hours per calendar year unless otherwise provided by law

Review our full benefits available by employment status here https://careers.usbank.com/global/en/benefits/us

Equal Opportunity

U.S. Bank is an equal opportunity employer. We consider all qualified applicants without regard to race, religion, color, sex, national origin, age, sexual orientation, gender identity, disability or veteran status, and other factors protected under applicable law.

E-Verify

U.S. Bank participates in the U.S. Department of Homeland Security E-Verify program in all facilities located in the United States and certain U.S. territories. The E-Verify program is an Internet-based employment eligibility verification system operated by the U.S. Citizenship and Immigration Services. Learn more about the E-Verify program https://careers.usbank.com/verification-of-eligibility-for-employment

Salary and Benefits

The salary range reflects figures based on the primary location, which is listed first. The actual range for the role may differ based on the location of the role. In addition to salary, U.S. Bank offers a comprehensive benefits package, including incentive and recognition programs, equity stock purchase 401(k) contribution and pension (all benefits are subject to eligibility requirements). Pay Range: $111,605.00 - $131,300.00

U.S. Bank will consider qualified applicants with arrest or conviction records for employment. U.S. Bank conducts background checks consistent with applicable local laws, including the Los Angeles County Fair Chance Ordinance and the California Fair Chance Act as well as the San Francisco Fair Chance Ordinance. U.S. Bank is subject to, and conducts background checks consistent with the requirements of Section 19 of the Federal Deposit Insurance Act (FDIA). In addition, certain positions may also be subject to the requirements of FINRA, NMLS registration, Reg Z, Reg G, OFAC, the NFA, the FCPA, the Bank Secrecy Act, the SAFE Act, and/or federal guidelines applicable to an agreement, such as those related to ethics, safety, or operational procedures.

Applicants must be able to comply with U.S. Bank policies and procedures including the Code of Ethics and Business Conduct and related workplace conduct and safety policies.

Posting may be closed earlier due to high volume of applicants.

Get your free, confidential resume review.
or drag and drop your file here.
Similar jobs

Similar jobs worth comparing

Sr. Software Engineer - (ISO 20022, SWIFT, CHIPS, and Fedwire payment ecosystems)
Sr. Software Engineer - (ISO 20022, SWIFT, CHIPS, and Fedwire payment ecosystems)

Us Bank • Charlotte (NC)

Hybrid
USD 112,000 - 131,000
Senior Software Engineer - 3 (Full Stack)
Senior Software Engineer - 3 (Full Stack)

Us Bank • Irving (TX)

Hybrid
USD 110,000 - 160,000
Healthcare
401(k)
Paid vacation
+4
Sr. Software Engineer - (ISO 20022, SWIFT, CHIPS, and Fedwire payment ecosystems)
Sr. Software Engineer - (ISO 20022, SWIFT, CHIPS, and Fedwire payment ecosystems)

U.S. Bank • Northern (KY)

Hybrid
USD 112,000 - 131,000
Healthcare benefits
401(k) plan
Paid vacation
Sr. Technology Architect
Sr. Technology Architect

U.S. Bank • Denver (CO)

On-site
USD 150,000 - 190,000
Software Engineer 2 (Performance Engineering)
Software Engineer 2 (Performance Engineering)

U.S. Bank • Charlotte (NC)

On-site
USD 105,000 - 124,000
Healthcare (medical, dental, vision)
401(k) with employer contribution
Paid vacation
+2
Senior Software Engineer (Data & Integration)
Senior Software Engineer (Data & Integration)

U.S. Bank • Atlanta (GA)

On-site
USD 120,000 - 141,000
Healthcare
401(k) Plan
Paid vacation
+1
Lead Software Engineer (Front-End Engineer)
Lead Software Engineer (Front-End Engineer)

Us Bank • Charlotte (NC)

On-site
USD 127,000 - 149,000
Healthcare (medical, dental, vision)
401(k) and retirement plan
Paid vacation
+3
Embedded Payments Account Manager
Embedded Payments Account Manager

U.S. Bank • Phoenix (AZ)

On-site
USD 105,000 - 124,000
Healthcare (medical, dental, vision)
401(k) and employer-funded retirement
Paid vacation
+2
Wire Transfer Core Modernization Analyst
Wire Transfer Core Modernization Analyst

Us Bank • Saint Paul (MN)

On-site
USD 93,000 - 109,000
Healthcare (medical, dental, vision)
401(k) plan
Paid vacation
+2
Software Engineering Director 2 - Corporate Digital Technology
Software Engineering Director 2 - Corporate Digital Technology

U.S. Bank • Charlotte (NC)

On-site
USD 170,000 - 200,000